Class b: All beta proteins [48724] (144 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain (Pfam 05738) [49478] (1 family) |
Family b.3.5.1: Cna protein B-type domain (Pfam 05738) [49479] (2 proteins) |
Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species) the penultimate strand is in the other beta-sheet than in the Cna repeats |
Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries) |
Domain d1ti4l1: 1ti4 L:196-274 [106972] Other proteins in same PDB: d1ti4a1, d1ti4a2, d1ti4b2, d1ti4c1, d1ti4c2, d1ti4d2, d1ti4e1, d1ti4e2, d1ti4f2, d1ti4g1, d1ti4g2, d1ti4h2, d1ti4i1, d1ti4i2, d1ti4j2, d1ti4k1, d1ti4k2, d1ti4l2 |
PDB Entry: 1ti4 (more details), 2.2 Å
SCOP Domain Sequences for d1ti4l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti4l1 b.3.5.1 (L:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici} knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks ysdtvviddksvdlgfikl
Timeline for d1ti4l1: