SCOP 1.69: Domain d1ti4f2: 1ti4 F:1-195

Lineage for d1ti4f2 (1ti4 F:1-195)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (9 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)

7. Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)

8. Domain d1ti4f2: 1ti4 F:1-195 [106961]
   Other proteins in same PDB: d1ti4a1, d1ti4a2, d1ti4b1, d1ti4c1, d1ti4c2, d1ti4d1, d1ti4e1, d1ti4e2, d1ti4f1, d1ti4g1, d1ti4g2, d1ti4h1, d1ti4i1, d1ti4i2, d1ti4j1, d1ti4k1, d1ti4k2, d1ti4l1

Details for d1ti4f2

PDB Entry: 1ti4, 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol

SCOP Domain Sequences for d1ti4f2:

Sequence; same for both SEQRES and ATOM records:

>d1ti4f2 d.58.1.5 (F:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

Timeline for d1ti4f2:

• d1ti4f2 is new in SCOP 1.69
  
• d1ti4f2 appears in SCOP 1.71
  
• d1ti4f2 appears in the current release, SCOPe 2.08