Class b: All beta proteins [48724] (176 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
Protein Transhydroxylase alpha subunit, AthL [110250] (1 species) |
Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries) Uniprot P80563 |
Domain d1ti4a1: 1ti4 A:729-875 [106950] Other proteins in same PDB: d1ti4a2, d1ti4b1, d1ti4b2, d1ti4c2, d1ti4d1, d1ti4d2, d1ti4e2, d1ti4f1, d1ti4f2, d1ti4g2, d1ti4h1, d1ti4h2, d1ti4i2, d1ti4j1, d1ti4j2, d1ti4k2, d1ti4l1, d1ti4l2 complexed with 4mo, ca, mgd, pyg, sf4 complexed with 4mo, ca, mgd, pyg, sf4 |
PDB Entry: 1ti4 (more details), 2.2 Å
SCOPe Domain Sequences for d1ti4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ti4a1 b.52.2.2 (A:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi skyacgmanntalveiekwdgdkyeiy
Timeline for d1ti4a1: