Lineage for d1ti2f2 (1ti2 F:1-195)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906422Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1906564Protein Transhydroxylase beta subunit, BthL, N-terminal domain [110948] (1 species)
  7. 1906565Species Pelobacter acidigallici [TaxId:35816] [110949] (6 PDB entries)
    Uniprot P80564
  8. 1906592Domain d1ti2f2: 1ti2 F:1-195 [106937]
    Other proteins in same PDB: d1ti2a1, d1ti2a2, d1ti2b1, d1ti2c1, d1ti2c2, d1ti2d1, d1ti2e1, d1ti2e2, d1ti2f1, d1ti2g1, d1ti2g2, d1ti2h1, d1ti2i1, d1ti2i2, d1ti2j1, d1ti2k1, d1ti2k2, d1ti2l1
    complexed with 4mo, act, ca, mgd, sf4
    complexed with 4mo, act, ca, mgd, sf4

Details for d1ti2f2

PDB Entry: 1ti2 (more details), 2.35 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici
PDB Compounds: (F:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1ti2f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti2f2 d.58.1.5 (F:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
meqyymvidvakcqdcnncfmgcmdehelnewpgytasmqrghrwmnierrergtyprnd
inyrptpcmhcenapcvakgngavyqredgivlidpekakgkkelldtcpygvmywneee
nvaqkctmcahllddeswapkmprcahncgsfvyeflkttpeamakkveeeglevikpel
gtkprvyyknlyrfe

SCOPe Domain Coordinates for d1ti2f2:

Click to download the PDB-style file with coordinates for d1ti2f2.
(The format of our PDB-style files is described here.)

Timeline for d1ti2f2: