Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
Superfamily c.13.2: SpoIIaa-like [52091] (3 families) |
Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein) automatically mapped to Pfam PF01740 |
Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries) Uniprot O32726 # 90% sequence identity |
Domain d1thnd_: 1thn D: [106919] Other proteins in same PDB: d1thna1, d1thna2, d1thnc1, d1thnc2 complexed with adp, dmf |
PDB Entry: 1thn (more details), 2.5 Å
SCOPe Domain Sequences for d1thnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1thnd_ c.13.2.1 (D:) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]} slaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdssgl gvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
Timeline for d1thnd_: