SCOPe 2.08: Domain d1thna1: 1thn A:2-136

Lineage for d1thna1 (1thn A:2-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein Anti-sigma factor spoIIab [75535] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)
   Uniprot O32727

8. Domain d1thna1: 1thn A:2-136 [106916]
   Other proteins in same PDB: d1thna2, d1thnb_, d1thnc2, d1thnd_
   complexed with adp, dmf

Details for d1thna1

PDB Entry: 1thn, 2.5 Å

PDB Description: Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: inhibitory complex with ADP, crystal form I

PDB Compounds: (A:) Anti-sigma F factor

SCOPe Domain Sequences for d1thna1:

Sequence; same for both SEQRES and ATOM records:

>d1thna1 d.122.1.3 (A:2-136) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}
rnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndpn
givsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdevi
vesevnkgttvylkk

Timeline for d1thna1:

• d1thna1 first appeared in SCOP 1.69, called d1thna_
  
• d1thna1 appears in SCOPe 2.07