Lineage for d1th0b_ (1th0 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015342Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1015359Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)
  7. 1015360Species Human (Homo sapiens) [TaxId:9606] [110772] (6 PDB entries)
    Uniprot Q9HC62 366-589
  8. 1015362Domain d1th0b_: 1th0 B: [106904]

Details for d1th0b_

PDB Entry: 1th0 (more details), 2.2 Å

PDB Description: Structure of human Senp2
PDB Compounds: (B:) Sentrin-specific protease 2

SCOPe Domain Sequences for d1th0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1th0b_ d.3.1.7 (B:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
eltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllver
nkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvidl
rkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlngs
dcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

SCOPe Domain Coordinates for d1th0b_:

Click to download the PDB-style file with coordinates for d1th0b_.
(The format of our PDB-style files is described here.)

Timeline for d1th0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1th0a_