SCOPe 2.06: Domain d1tgzb_: 1tgz B:

Lineage for d1tgzb_ (1tgz B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries)
   Uniprot Q93068

8. Domain d1tgzb_: 1tgz B: [106902]
   Other proteins in same PDB: d1tgza_
   complexed with so4

Details for d1tgzb_

PDB Entry: 1tgz, 2.8 Å

PDB Description: Structure of human Senp2 in complex with SUMO-1

PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d1tgzb_:

Sequence; same for both SEQRES and ATOM records:

>d1tgzb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

Timeline for d1tgzb_:

• d1tgzb_ first appeared in SCOP 1.69
  
• d1tgzb_ appears in SCOPe 2.05
  
• d1tgzb_ appears in SCOPe 2.07
  
• d1tgzb_ appears in the current release, SCOPe 2.08