SCOP 1.75: Domain d1tgza_: 1tgz A:

Lineage for d1tgza_ (1tgz A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (5 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110772] (6 PDB entries)
   Uniprot Q9HC62 366-589

8. Domain d1tgza_: 1tgz A: [106901]
   Other proteins in same PDB: d1tgzb_
   complexed with so4

Details for d1tgza_

PDB Entry: 1tgz, 2.8 Å

PDB Description: Structure of human Senp2 in complex with SUMO-1

PDB Compounds: (A:) Sentrin-specific protease 2

SCOP Domain Sequences for d1tgza_:

Sequence; same for both SEQRES and ATOM records:

>d1tgza_ d.3.1.7 (A:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
sdcgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

Timeline for d1tgza_:

• d1tgza_ first appeared in SCOP 1.69
  
• d1tgza_ appears in SCOP 1.73
  
• d1tgza_ appears in SCOPe 2.01
  
• d1tgza_ appears in the current release, SCOPe 2.08