SCOPe 2.06: Domain d1tg8a1: 1tg8 A:298-395

Lineage for d1tg8a1 (1tg8 A:298-395)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
   Uniprot P12823 281-675 # 99% sequence identity

8. Domain d1tg8a1: 1tg8 A:298-395 [106892]
   Other proteins in same PDB: d1tg8a2
   complexed with ndg

Details for d1tg8a1

PDB Entry: 1tg8, 2.61 Å

PDB Description: the structure of dengue virus e glycoprotein

PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d1tg8a1:

Sequence; same for both SEQRES and ATOM records:

>d1tg8a1 b.1.18.4 (A:298-395) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlkldwfkkg

Timeline for d1tg8a1:

• d1tg8a1 first appeared in SCOP 1.69
  
• d1tg8a1 appears in SCOPe 2.05
  
• d1tg8a1 appears in SCOPe 2.07
  
• d1tg8a1 appears in the current release, SCOPe 2.08