SCOP 1.71: Domain d1tfza1: 1tfz A:15-180

Lineage for d1tfza1 (1tfz A:15-180)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species)

7. Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [110877] (4 PDB entries)

8. Domain d1tfza1: 1tfz A:15-180 [106886]

Details for d1tfza1

PDB Entry: 1tfz, 1.8 Å

PDB Description: structural basis for herbicidal inhibitor selectivity revealed by comparison of crystal structures of plant and mammalian 4- hydroxyphenylpyruvate dioxygenases

SCOP Domain Sequences for d1tfza1:

Sequence, based on SEQRES records:

>d1tfza1 d.32.1.3 (A:15-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana)}
npksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgdl
rflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafsi
svangaipssppivlneavtiaevklygdvvlryvsykaedtekse

Sequence, based on observed residues (ATOM records):

>d1tfza1 d.32.1.3 (A:15-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana)}
npksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasylltsgdl
rflftapyspslsageikptttasipsfdhgscrsffsshglgvravaievedaesafsi
svangaipssppivlneavtiaevklygdvvlryvsyke

Timeline for d1tfza1:

• d1tfza1 first appeared in SCOP 1.69
  
• d1tfza1 appears in SCOP 1.73
  
• d1tfza1 appears in the current release, SCOPe 2.08