SCOP 1.69: Domain d1tfva2: 1tfv A:240-307

Lineage for d1tfva2 (1tfv A:240-307)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (4 species)
   secreted during involution

7. Species Buffalo (Bubalus bubalis) [TaxId:89462] [110873] (1 PDB entry)

8. Domain d1tfva2: 1tfv A:240-307 [106861]
   Other proteins in same PDB: d1tfva1

Details for d1tfva2

PDB Entry: 1tfv, 2.9 Å

PDB Description: crystal structure of a buffalo signaling glycoprotein (spb-40) secreted during involution

SCOP Domain Sequences for d1tfva2:

Sequence; same for both SEQRES and ATOM records:

>d1tfva2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Buffalo (Bubalus bubalis)}
grsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatk
gnqwvayd

Timeline for d1tfva2:

• d1tfva2 is new in SCOP 1.69
  
• d1tfva2 appears in SCOP 1.71
  
• d1tfva2 appears in the current release, SCOPe 2.08