Lineage for d1tffa_ (1tff A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192413Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (2 proteins)
    probably the same as Pfam PF02338, OTU-like cysteine protease, but 1TFF (Uniprot Q96DC9) was not detected by the Pfam model
  6. 1192414Protein Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110774] (1 species)
  7. 1192415Species Human (Homo sapiens) [TaxId:9606] [110775] (1 PDB entry)
    Uniprot Q96DC9
  8. 1192416Domain d1tffa_: 1tff A: [106854]

Details for d1tffa_

PDB Entry: 1tff (more details), 2.1 Å

PDB Description: structure of otubain-2
PDB Compounds: (A:) Ubiquitin thiolesterase protein OTUB2

SCOPe Domain Sequences for d1tffa_:

Sequence, based on SEQRES records: (download)

>d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens) [TaxId: 9606]}
nlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesllg
ksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndqs
asdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsqa
lsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaadkh

Sequence, based on observed residues (ATOM records): (download)

>d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens) [TaxId: 9606]}
nlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesllg
ksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndqs
asdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsqa
lsialqveyvdhhvfpeaatpsvyllyktshynilyaadkh

SCOPe Domain Coordinates for d1tffa_:

Click to download the PDB-style file with coordinates for d1tffa_.
(The format of our PDB-style files is described here.)

Timeline for d1tffa_: