Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (12 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (1 protein) probably the same as Pfam 02338, OTU-like cysteine protease, but 1TFF (SQ Q96DC9) was not detected by the Pfam model |
Protein Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110774] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110775] (1 PDB entry) |
Domain d1tffa_: 1tff A: [106854] mutant |
PDB Entry: 1tff (more details), 2.1 Å
SCOP Domain Sequences for d1tffa_:
Sequence, based on SEQRES records: (download)
>d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens)} nlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesllg ksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndqs asdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsqa lsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaadkh
>d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens)} nlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesllg ksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndqs asdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsqa lsialqveyvdhhvfpeaatpsvyllyktshynilyaadkh
Timeline for d1tffa_: