SCOP 1.71: Domain d1tffa_: 1tff A:

Lineage for d1tffa_ (1tff A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (12 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (1 protein)
   probably the same as Pfam 02338, OTU-like cysteine protease, but 1TFF (SQ Q96DC9) was not detected by the Pfam model

6. Protein Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110774] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110775] (1 PDB entry)

8. Domain d1tffa_: 1tff A: [106854]
   mutant

Details for d1tffa_

PDB Entry: 1tff, 2.1 Å

PDB Description: structure of otubain-2

SCOP Domain Sequences for d1tffa_:

Sequence, based on SEQRES records:

>d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens)}
nlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesllg
ksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndqs
asdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsqa
lsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaadkh

Sequence, based on observed residues (ATOM records):

>d1tffa_ d.3.1.11 (A:) Ubiquitin thiolesterase protein OTUB2 (Otubain-2) {Human (Homo sapiens)}
nlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesllg
ksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndqs
asdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsqa
lsialqveyvdhhvfpeaatpsvyllyktshynilyaadkh

Timeline for d1tffa_:

• d1tffa_ first appeared in SCOP 1.69
  
• d1tffa_ appears in SCOP 1.73
  
• d1tffa_ appears in the current release, SCOPe 2.08