Lineage for d1tfca_ (1tfc A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923541Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 923542Species Human (Homo sapiens) [TaxId:9606] [81917] (13 PDB entries)
    Uniprot O75454 233-458
  8. 923562Domain d1tfca_: 1tfc A: [106850]
    Other proteins in same PDB: d1tfcc_, d1tfcd_

Details for d1tfca_

PDB Entry: 1tfc (more details), 2.4 Å

PDB Description: crystal structure of the ligand-binding domain of the estrogen-related receptor gamma in complex with a steroid receptor coactivator-1 peptide
PDB Compounds: (A:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d1tfca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfca_ a.123.1.1 (A:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv

SCOPe Domain Coordinates for d1tfca_:

Click to download the PDB-style file with coordinates for d1tfca_.
(The format of our PDB-style files is described here.)

Timeline for d1tfca_: