Lineage for d1teed_ (1tee D:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 593922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 594204Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 594345Protein Polyketide synthase PKS18 [110758] (1 species)
  7. 594346Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
  8. 594354Domain d1teed_: 1tee D: [106814]
    mutant

Details for d1teed_

PDB Entry: 1tee (more details), 2.9 Å

PDB Description: Crystal structure of C205F mutant of PKS18 from Mycobacterium tuberculosis

SCOP Domain Sequences for d1teed_:

Sequence, based on SEQRES records: (download)

>d1teed_ c.95.1.2 (D:) Polyketide synthase PKS18 {Mycobacterium tuberculosis}
tvavieglatgtprrvvnqsdaadrvaelfldpgqreriprvyqksrittrrmavdplda
kfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapg
vdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielfsvnav
faddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnh
ngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgis
aelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdi
irr

Sequence, based on observed residues (ATOM records): (download)

>d1teed_ c.95.1.2 (D:) Polyketide synthase PKS18 {Mycobacterium tuberculosis}
tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielfsvnavfadd
indvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnhngit
celsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgisaela
aqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdiirr

SCOP Domain Coordinates for d1teed_:

Click to download the PDB-style file with coordinates for d1teed_.
(The format of our PDB-style files is described here.)

Timeline for d1teed_: