Lineage for d1teec_ (1tee C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495506Family c.95.1.2: Chalcone synthase-like [53914] (7 proteins)
  6. 495597Protein Polyketide synthase PKS18 [110758] (1 species)
  7. 495598Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
  8. 495605Domain d1teec_: 1tee C: [106813]

Details for d1teec_

PDB Entry: 1tee (more details), 2.9 Å

PDB Description: Crystal structure of C205F mutant of PKS18 from Mycobacterium tuberculosis

SCOP Domain Sequences for d1teec_:

Sequence, based on SEQRES records: (download)

>d1teec_ c.95.1.2 (C:) Polyketide synthase PKS18 {Mycobacterium tuberculosis}
aqlppappttvavieglatgtprrvvnqsdaadrvaelfldpgqreriprvyqksrittr
rmavdpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvla
tstgfiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvc
ielfsvnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldnte
dgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiie
qsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgv
tvegmlfdiirr

Sequence, based on observed residues (ATOM records): (download)

>d1teec_ c.95.1.2 (C:) Polyketide synthase PKS18 {Mycobacterium tuberculosis}
aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielf
svnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgiv
lgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvr
slgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtveg
mlfdiirr

SCOP Domain Coordinates for d1teec_:

Click to download the PDB-style file with coordinates for d1teec_.
(The format of our PDB-style files is described here.)

Timeline for d1teec_: