Lineage for d1teeb_ (1tee B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846958Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 846959Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 847355Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 847544Protein Polyketide synthase PKS18 [110758] (1 species)
  7. 847545Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
    Uniprot Q79FQ0
  8. 847551Domain d1teeb_: 1tee B: [106812]

Details for d1teeb_

PDB Entry: 1tee (more details), 2.9 Å

PDB Description: Crystal structure of C205F mutant of PKS18 from Mycobacterium tuberculosis
PDB Compounds: (B:) pks18

SCOP Domain Sequences for d1teeb_:

Sequence, based on SEQRES records: (download)

>d1teeb_ c.95.1.2 (B:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
tvavieglatgtprrvvnqsdaadrvaelfldpgqreriprvyqksrittrrmavdplda
kfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapg
vdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielfsvnav
faddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnh
ngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgis
aelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdi
irr

Sequence, based on observed residues (ATOM records): (download)

>d1teeb_ c.95.1.2 (B:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
tvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmavdpldakfdv
frrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstgfiapgvdva
ivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielfsvnavfadd
indvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgivlgvnhngit
celsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvrslgisaela
aqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtvegmlfdiirr

SCOP Domain Coordinates for d1teeb_:

Click to download the PDB-style file with coordinates for d1teeb_.
(The format of our PDB-style files is described here.)

Timeline for d1teeb_: