Lineage for d1teea_ (1tee A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392579Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1392793Protein Polyketide synthase PKS18 [110758] (1 species)
  7. 1392794Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
    Uniprot Q79FQ0
  8. 1392799Domain d1teea_: 1tee A: [106811]
    mutant

Details for d1teea_

PDB Entry: 1tee (more details), 2.9 Å

PDB Description: Crystal structure of C205F mutant of PKS18 from Mycobacterium tuberculosis
PDB Compounds: (A:) pks18

SCOPe Domain Sequences for d1teea_:

Sequence, based on SEQRES records: (download)

>d1teea_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
aqlppappttvavieglatgtprrvvnqsdaadrvaelfldpgqreriprvyqksrittr
rmavdpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvla
tstgfiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvc
ielfsvnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldnte
dgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiie
qsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgv
tvegmlfdiirr

Sequence, based on observed residues (ATOM records): (download)

>d1teea_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}
aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielf
svnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgiv
lgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvr
slgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtveg
mlfdiirr

SCOPe Domain Coordinates for d1teea_:

Click to download the PDB-style file with coordinates for d1teea_.
(The format of our PDB-style files is described here.)

Timeline for d1teea_: