Lineage for d1teda_ (1ted A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495506Family c.95.1.2: Chalcone synthase-like [53914] (7 proteins)
  6. 495597Protein Polyketide synthase PKS18 [110758] (1 species)
  7. 495598Species Mycobacterium tuberculosis [TaxId:1773] [110759] (2 PDB entries)
  8. 495599Domain d1teda_: 1ted A: [106807]

Details for d1teda_

PDB Entry: 1ted (more details), 2.25 Å

PDB Description: Crystal structure of a type III polyketide synthase PKS18 from Mycobacterium tuberculosis

SCOP Domain Sequences for d1teda_:

Sequence, based on SEQRES records: (download)

>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis}
aqlppappttvavieglatgtprrvvnqsdaadrvaelfldpgqreriprvyqksrittr
rmavdpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvla
tstgfiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvc
ielcsvnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldnte
dgivlgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiie
qsvrslgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgv
tvegmlfdiirr

Sequence, based on observed residues (ATOM records): (download)

>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis}
aqlppappttvavieglatgtprrvvnqsdaadrvaelgqreriprvyqksrittrrmav
dpldakfdvfrrepatirdrmhlfyehavplavdvskralaglpyraaeigllvlatstg
fiapgvdvaivkelglspsisrvvvnfmgcaaamnalgtatnyvrahpamkalvvcielc
svnavfaddindvvihslfgdgcaalvigasqvqeklepgkvvvrssfsqlldntedgiv
lgvnhngitcelsenlpgyifsgvapvvtemlwdnglqisdidlwaihpggpkiieqsvr
slgisaelaaqswdvlarfgnmlsvslifvletmvqqaesakaistgvafafgpgvtveg
mlfdiirr

SCOP Domain Coordinates for d1teda_:

Click to download the PDB-style file with coordinates for d1teda_.
(The format of our PDB-style files is described here.)

Timeline for d1teda_: