SCOP 1.69: Domain d1teaa1: 1tea A:164-296

Lineage for d1teaa1 (1tea A:164-296)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins)
   Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain

6. Protein Hydroxyisobutyrate dehydrogenase [101357] (2 species)
   forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively

7. Species Salmonella typhimurium [TaxId:90371] [109948] (1 PDB entry)

8. Domain d1teaa1: 1tea A:164-296 [106804]
   Other proteins in same PDB: d1teaa2

Details for d1teaa1

PDB Entry: 1tea, 1.65 Å

PDB Description: X-ray crystal structure of tartronate semialdehyde reductase [Salmonella typhimurium LT2]

SCOP Domain Sequences for d1teaa1:

Sequence; same for both SEQRES and ATOM records:

>d1teaa1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium}
digagnvtklanqvivalniaamsealtlatkagvnpdlvyqairgglagstvldakapm
vmdrnfkpgfridlhikdlanaldtshgvgaqlpltaavmemmqalradghgnddhsala
cyyeklakvevtr

Timeline for d1teaa1:

• d1teaa1 is new in SCOP 1.69
  
• d1teaa1 does not appear in SCOP 1.71