Lineage for d1te6b1 (1te6 B:140-433)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572967Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 572968Family c.1.11.1: Enolase [51605] (1 protein)
  6. 572969Protein Enolase [51606] (6 species)
    Fold of this protein slightly differs from common fold in topology
  7. 573002Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (1 PDB entry)
  8. 573004Domain d1te6b1: 1te6 B:140-433 [106799]
    Other proteins in same PDB: d1te6a2, d1te6b2
    complexed with cl, mg, po4, trs

Details for d1te6b1

PDB Entry: 1te6 (more details), 1.8 Å

PDB Description: crystal structure of human neuron specific enolase at 1.8 angstrom

SCOP Domain Sequences for d1te6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te6b1 c.1.11.1 (B:140-433) Enolase {Human (Homo sapiens), gamma isoform}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl

SCOP Domain Coordinates for d1te6b1:

Click to download the PDB-style file with coordinates for d1te6b1.
(The format of our PDB-style files is described here.)

Timeline for d1te6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1te6b2