SCOP 1.69: Domain d1te6b1: 1te6 B:140-433

Lineage for d1te6b1 (1te6 B:140-433)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this family

5. Family c.1.11.1: Enolase [51605] (1 protein)

6. Protein Enolase [51606] (6 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (1 PDB entry)

8. Domain d1te6b1: 1te6 B:140-433 [106799]
   Other proteins in same PDB: d1te6a2, d1te6b2

Details for d1te6b1

PDB Entry: 1te6, 1.8 Å

PDB Description: crystal structure of human neuron specific enolase at 1.8 angstrom

SCOP Domain Sequences for d1te6b1:

Sequence; same for both SEQRES and ATOM records:

>d1te6b1 c.1.11.1 (B:140-433) Enolase {Human (Homo sapiens), gamma isoform}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsvl

Timeline for d1te6b1:

• d1te6b1 is new in SCOP 1.69
  
• d1te6b1 appears in SCOP 1.71
  
• d1te6b1 appears in the current release, SCOPe 2.08