Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Aggrecan core protein [111260] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [111261] (1 PDB entry) Uniprot P07897 1912-2037 |
Domain d1tdqb_: 1tdq B: [106785] Other proteins in same PDB: d1tdqa1, d1tdqa2, d1tdqa3, d1tdqa4 complexed with ca |
PDB Entry: 1tdq (more details), 2.6 Å
SCOPe Domain Sequences for d1tdqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Norway rat (Rattus norvegicus) [TaxId: 10116]} eqceegwtkfqghcyrhfpdretwvdaerrcreqqshlssivtpeeqefvnknaqdyqwi glndrtiegdfrwsdghslqfekwrpnqpdnffatgedcvvmiwhergewndvpcnyqlp ftckkg
Timeline for d1tdqb_:
View in 3D Domains from other chains: (mouse over for more information) d1tdqa1, d1tdqa2, d1tdqa3, d1tdqa4 |