Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Tenascin [49273] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [110057] (1 PDB entry) Uniprot Q05546 502-770 |
Domain d1tdqa1: 1tdq A:3-93 [106782] Other proteins in same PDB: d1tdqa4, d1tdqb_ complexed with ca |
PDB Entry: 1tdq (more details), 2.6 Å
SCOPe Domain Sequences for d1tdqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdqa1 b.1.2.1 (A:3-93) Tenascin {Norway rat (Rattus norvegicus) [TaxId: 10116]} vidgptqilvrdvsdtvafvewtpprakvdfillkyglvggeggkttfrlqpplsqysvq alrpgsryevsisavrgtnesdasstqftte
Timeline for d1tdqa1: