![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins) contains 4 helices in the core |
![]() | Protein Endonuclease VIII-like 1 (NEIL1) [109740] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109741] (1 PDB entry) Uniprot Q96FI4 1-333 |
![]() | Domain d1tdha1: 1tdh A:132-246 [106772] Other proteins in same PDB: d1tdha2, d1tdha3 complexed with trs |
PDB Entry: 1tdh (more details), 2.1 Å
SCOPe Domain Sequences for d1tdha1:
Sequence, based on SEQRES records: (download)
>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]} grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf ekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlggrgygs
>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]} grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf ekarsvlealqpeltlsqkirtklqnpdllelchsvpkevvqlggrgygs
Timeline for d1tdha1: