SCOP 1.73: Domain d1tdha1: 1tdh A:132-246

Lineage for d1tdha1 (1tdh A:132-246)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein Endonuclease VIII-like 1 (NEIL1) [109740] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109741] (1 PDB entry)

8. Domain d1tdha1: 1tdh A:132-246 [106772]
   Other proteins in same PDB: d1tdha2, d1tdha3
   complexed with tmn

Details for d1tdha1

PDB Entry: 1tdh, 2.1 Å

PDB Description: Crystal structure of human endonuclease VIII-like 1 (NEIL1)

PDB Compounds: (A:) nei endonuclease VIII-like 1

SCOP Domain Sequences for d1tdha1:

Sequence, based on SEQRES records:

>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlggrgygs

Sequence, based on observed residues (ATOM records):

>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]}
grgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylraeilyrlkippf
ekarsvlealqpeltlsqkirtklqnpdllelchsvpkevvqlggrgygs

Timeline for d1tdha1:

• d1tdha1 first appeared in SCOP 1.69
  
• d1tdha1 appears in SCOP 1.71
  
• d1tdha1 appears in SCOP 1.75
  
• d1tdha1 appears in the current release, SCOPe 2.08