SCOPe 2.08: Domain d1tbxa1: 1tbx A:3-93

Lineage for d1tbxa1 (1tbx A:3-93)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.48: F93-like [109674] (4 proteins)
   contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers

6. Protein Hypothetical protein F93 [109675] (1 species)

7. Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [109676] (1 PDB entry)
   Uniprot P20222

8. Domain d1tbxa1: 1tbx A:3-93 [106748]
   Other proteins in same PDB: d1tbxa2

Details for d1tbxa1

PDB Entry: 1tbx, 2.7 Å

PDB Description: Crystal structure of SSV1 F-93

PDB Compounds: (A:) Hypothetical 11.0 kDa protein

SCOPe Domain Sequences for d1tbxa1:

Sequence; same for both SEQRES and ATOM records:

>d1tbxa1 a.4.5.48 (A:3-93) Hypothetical protein F93 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]}
stpffypeaivlaylydnegiatydlykkvnaefpmstatfydakkfliqegfvkerqer
gekrlyltekgklfaislktaietykqikkr

Timeline for d1tbxa1:

• d1tbxa1 first appeared in SCOP 1.69, called d1tbxa_
  
• d1tbxa1 appears in SCOPe 2.07