Lineage for d1tb6i_ (1tb6 I:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517080Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 517081Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 517082Family e.1.1.1: Serpins [56575] (15 proteins)
  6. 517093Protein Antithrombin [56584] (2 species)
  7. 517097Species Human (Homo sapiens) [TaxId:9606] [56586] (16 PDB entries)
  8. 517098Domain d1tb6i_: 1tb6 I: [106738]
    Other proteins in same PDB: d1tb6.1

Details for d1tb6i_

PDB Entry: 1tb6 (more details), 2.5 Å

PDB Description: 2.5a crystal structure of the antithrombin-thrombin-heparin ternary complex

SCOP Domain Sequences for d1tb6i_:

Sequence, based on SEQRES records: (download)

>d1tb6i_ e.1.1.1 (I:) Antithrombin {Human (Homo sapiens)}
pvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfattfy
qhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfff
aklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsr
aainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykad
gescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpev
lqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddly
vsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifm
grvanpcv

Sequence, based on observed residues (ATOM records): (download)

>d1tb6i_ e.1.1.1 (I:) Antithrombin {Human (Homo sapiens)}
pvdictakprdipmnpmciyrspeqkipeatnrrvwelskansrfattfyqhladskndn
dniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrk
ankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnk
tegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmy
qegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldelee
mmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkafl
evneegtavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcv

SCOP Domain Coordinates for d1tb6i_:

Click to download the PDB-style file with coordinates for d1tb6i_.
(The format of our PDB-style files is described here.)

Timeline for d1tb6i_: