Lineage for d1t95a3 (1t95 A:162-234)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206180Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 1206258Family d.58.11.3: Hypothetical protein AF0491, C-terminal domain [110976] (1 protein)
  6. 1206259Protein Hypothetical protein AF0491, C-terminal domain [110977] (1 species)
  7. 1206260Species Archaeoglobus fulgidus [TaxId:2234] [110978] (2 PDB entries)
    Uniprot O29759
  8. 1206261Domain d1t95a3: 1t95 A:162-234 [106707]
    Other proteins in same PDB: d1t95a1, d1t95a2

Details for d1t95a3

PDB Entry: 1t95 (more details), 1.9 Å

PDB Description: Crystal Structure of the Shwachman-Bodian-Diamond Syndrome Protein Orthologue from Archaeoglobus fulgidus
PDB Compounds: (A:) Hypothetical protein AF0491

SCOPe Domain Sequences for d1t95a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t95a3 d.58.11.3 (A:162-234) Hypothetical protein AF0491, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
ilplkfeemeiaikippehtgraisalynfggvtreewqrdgswicvmripsgmygdlmd
llgkvakgealtk

SCOPe Domain Coordinates for d1t95a3:

Click to download the PDB-style file with coordinates for d1t95a3.
(The format of our PDB-style files is described here.)

Timeline for d1t95a3: