![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
![]() | Family d.58.11.3: Hypothetical protein AF0491, C-terminal domain [110976] (1 protein) |
![]() | Protein Hypothetical protein AF0491, C-terminal domain [110977] (1 species) |
![]() | Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110978] (2 PDB entries) |
![]() | Domain d1t95a3: 1t95 A:162-234 [106707] Other proteins in same PDB: d1t95a1, d1t95a2 |
PDB Entry: 1t95 (more details), 1.9 Å
SCOP Domain Sequences for d1t95a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t95a3 d.58.11.3 (A:162-234) Hypothetical protein AF0491, C-terminal domain {Archaeon Archaeoglobus fulgidus} ilplkfeemeiaikippehtgraisalynfggvtreewqrdgswicvmripsgmygdlmd llgkvakgealtk
Timeline for d1t95a3: