![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.235: FYSH domain [89894] (1 superfamily) beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234 |
![]() | Superfamily d.235.1: FYSH domain [89895] (3 families) ![]() |
![]() | Family d.235.1.2: Hypothetical protein AF0491, N-terminal domain [110893] (1 protein) automatically mapped to Pfam PF01172 |
![]() | Protein Hypothetical protein AF0491, N-terminal domain [110894] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [110895] (2 PDB entries) Uniprot O29759 |
![]() | Domain d1t95a2: 1t95 A:11-86 [106706] Other proteins in same PDB: d1t95a1, d1t95a3 |
PDB Entry: 1t95 (more details), 1.9 Å
SCOPe Domain Sequences for d1t95a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t95a2 d.235.1.2 (A:11-86) Hypothetical protein AF0491, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} dkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvdelr kifgtddvfeiarkii
Timeline for d1t95a2: