SCOPe 2.05: Domain d1t95a2: 1t95 A:11-86

Lineage for d1t95a2 (1t95 A:11-86)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.235: FYSH domain [89894] (1 superfamily)
   beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234

4. Superfamily d.235.1: FYSH domain [89895] (3 families)

5. Family d.235.1.2: Hypothetical protein AF0491, N-terminal domain [110893] (1 protein)
   automatically mapped to Pfam PF01172

6. Protein Hypothetical protein AF0491, N-terminal domain [110894] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [110895] (2 PDB entries)
   Uniprot O29759

8. Domain d1t95a2: 1t95 A:11-86 [106706]
   Other proteins in same PDB: d1t95a1, d1t95a3

Details for d1t95a2

PDB Entry: 1t95, 1.9 Å

PDB Description: Crystal Structure of the Shwachman-Bodian-Diamond Syndrome Protein Orthologue from Archaeoglobus fulgidus

PDB Compounds: (A:) Hypothetical protein AF0491

SCOPe Domain Sequences for d1t95a2:

Sequence; same for both SEQRES and ATOM records:

>d1t95a2 d.235.1.2 (A:11-86) Hypothetical protein AF0491, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
dkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvdelr
kifgtddvfeiarkii

Timeline for d1t95a2:

• d1t95a2 first appeared in SCOP 1.69
  
• d1t95a2 appears in SCOPe 2.04
  
• d1t95a2 appears in SCOPe 2.06
  
• d1t95a2 appears in the current release, SCOPe 2.08