Lineage for d1t95a1 (1t95 A:87-161)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439425Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 439549Superfamily a.5.8: Hypothetical protein AF0491, middle domain [109728] (1 family) (S)
  5. 439550Family a.5.8.1: Hypothetical protein AF0491, middle domain [109729] (1 protein)
  6. 439551Protein Hypothetical protein AF0491, middle domain [109730] (1 species)
  7. 439552Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [109731] (2 PDB entries)
  8. 439553Domain d1t95a1: 1t95 A:87-161 [106705]
    Other proteins in same PDB: d1t95a2, d1t95a3

Details for d1t95a1

PDB Entry: 1t95 (more details), 1.9 Å

PDB Description: Crystal Structure of the Shwachman-Bodian-Diamond Syndrome Protein Orthologue from Archaeoglobus fulgidus

SCOP Domain Sequences for d1t95a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t95a1 a.5.8.1 (A:87-161) Hypothetical protein AF0491, middle domain {Archaeon Archaeoglobus fulgidus}
legevqitaeqrremleakrkqiinfisrntidprtnaphppsrieraleeakvhidifk
sveaqvkdivkalkp

SCOP Domain Coordinates for d1t95a1:

Click to download the PDB-style file with coordinates for d1t95a1.
(The format of our PDB-style files is described here.)

Timeline for d1t95a1: