Lineage for d1t89b2 (1t89 B:342-443)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655861Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 655864Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries)
  8. 655902Domain d1t89b2: 1t89 B:342-443 [106660]
    Other proteins in same PDB: d1t89a1, d1t89b1, d1t89c1, d1t89c2
    complexed with fuc, gal, man, nag

Details for d1t89b2

PDB Entry: 1t89 (more details), 3.5 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (hexagonal)
PDB Compounds: (B:) recombinant IgG1 heavy chain

SCOP Domain Sequences for d1t89b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t89b2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1t89b2:

Click to download the PDB-style file with coordinates for d1t89b2.
(The format of our PDB-style files is described here.)

Timeline for d1t89b2: