Lineage for d1t89a2 (1t89 A:342-443)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293157Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 1293160Species Human (Homo sapiens) [TaxId:9606] [88590] (33 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1293213Domain d1t89a2: 1t89 A:342-443 [106658]
    Other proteins in same PDB: d1t89a1, d1t89b1, d1t89c1, d1t89c2

Details for d1t89a2

PDB Entry: 1t89 (more details), 3.5 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (hexagonal)
PDB Compounds: (A:) recombinant IgG1 heavy chain

SCOPe Domain Sequences for d1t89a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t89a2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d1t89a2:

Click to download the PDB-style file with coordinates for d1t89a2.
(The format of our PDB-style files is described here.)

Timeline for d1t89a2: