Lineage for d1t89a1 (1t89 A:235-341)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1108193Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1108194Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1108232Domain d1t89a1: 1t89 A:235-341 [106657]
    Other proteins in same PDB: d1t89a2, d1t89b2, d1t89c1, d1t89c2

Details for d1t89a1

PDB Entry: 1t89 (more details), 3.5 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (hexagonal)
PDB Compounds: (A:) recombinant IgG1 heavy chain

SCOPe Domain Sequences for d1t89a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t89a1 b.1.1.2 (A:235-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d1t89a1:

Click to download the PDB-style file with coordinates for d1t89a1.
(The format of our PDB-style files is described here.)

Timeline for d1t89a1: