![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (36 proteins) |
![]() | Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
![]() | Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries) |
![]() | Domain d1t83c2: 1t83 C:87-171 [106648] Other proteins in same PDB: d1t83a1, d1t83a2, d1t83b1, d1t83b2 complexed with fuc, gal, hg2, man, nag |
PDB Entry: 1t83 (more details), 3 Å
SCOP Domain Sequences for d1t83c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t83c2 b.1.1.4 (C:87-171) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl kdsgsyfcrglvgsknvssetvnit
Timeline for d1t83c2:
![]() Domains from other chains: (mouse over for more information) d1t83a1, d1t83a2, d1t83b1, d1t83b2 |