SCOP 1.69: Domain d1t83c2: 1t83 C:87-171

Lineage for d1t83c2 (1t83 C:87-171)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), III [TaxId:9606] [49199] (7 PDB entries)

8. Domain d1t83c2: 1t83 C:87-171 [106648]
   Other proteins in same PDB: d1t83a1, d1t83a2, d1t83b1, d1t83b2

Details for d1t83c2

PDB Entry: 1t83, 3 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (orthorhombic)

SCOP Domain Sequences for d1t83c2:

Sequence; same for both SEQRES and ATOM records:

>d1t83c2 b.1.1.4 (C:87-171) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnit

Timeline for d1t83c2:

• d1t83c2 is new in SCOP 1.69
  
• d1t83c2 appears in SCOP 1.71
  
• d1t83c2 appears in the current release, SCOPe 2.08