SCOP 1.69: Domain d1t83b2: 1t83 B:342-443

Lineage for d1t83b2 (1t83 B:342-443)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (22 PDB entries)

8. Domain d1t83b2: 1t83 B:342-443 [106646]
   Other proteins in same PDB: d1t83a1, d1t83b1, d1t83c1, d1t83c2

Details for d1t83b2

PDB Entry: 1t83, 3 Å

PDB Description: crystal structure of a human type iii fc gamma receptor in complex with an fc fragment of igg1 (orthorhombic)

SCOP Domain Sequences for d1t83b2:

Sequence; same for both SEQRES and ATOM records:

>d1t83b2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d1t83b2:

• d1t83b2 is new in SCOP 1.69
  
• d1t83b2 appears in SCOP 1.71
  
• d1t83b2 appears in the current release, SCOPe 2.08