Lineage for d1t7fa_ (1t7f A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923260Protein Androgen receptor [63621] (4 species)
  7. 923261Species Chimpanzee (Pan troglodytes) [TaxId:9598] [109986] (8 PDB entries)
    Uniprot O97775 661-910 # 100% sequence identity to human sequence (Uniprot P10275 669-918)
  8. 923263Domain d1t7fa_: 1t7f A: [106625]
    complexed with dht

Details for d1t7fa_

PDB Entry: 1t7f (more details), 1.6 Å

PDB Description: Crystal structure of the androgen receptor ligand binding domain in complex with a LxxLL motif
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d1t7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7fa_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]}
cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
gkvkpiyfht

SCOPe Domain Coordinates for d1t7fa_:

Click to download the PDB-style file with coordinates for d1t7fa_.
(The format of our PDB-style files is described here.)

Timeline for d1t7fa_: