Lineage for d1t6zb2 (1t6z B:302-458)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160658Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1160659Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1160905Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1160920Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)
  7. 1160921Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
    Uniprot Q9WZW1
    TM0379
  8. 1160929Domain d1t6zb2: 1t6z B:302-458 [106611]
    Other proteins in same PDB: d1t6za1, d1t6zb1
    complexed with rbf

Details for d1t6zb2

PDB Entry: 1t6z (more details), 2.4 Å

PDB Description: Crystal structure of riboflavin bound TM379
PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d1t6zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6zb2 c.26.1.3 (B:302-458) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
vyeiedvvvqgkrvssslirnlvqegrveeipaylgr

SCOPe Domain Coordinates for d1t6zb2:

Click to download the PDB-style file with coordinates for d1t6zb2.
(The format of our PDB-style files is described here.)

Timeline for d1t6zb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6zb1