SCOP 1.71: Domain d1t6db2: 1t6d B:133-307

Lineage for d1t6db2 (1t6d B:133-307)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein)
   Pfam 02541

6. Protein Exopolyphosphatase Ppx [110631] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries)

8. Domain d1t6db2: 1t6d B:133-307 [106563]
   complexed with cl, trs; mutant

Details for d1t6db2

PDB Entry: 1t6d, 2.15 Å

PDB Description: miras phasing of the aquifex aeolicus ppx/gppa phosphatase: crystal structure of the type ii variant

SCOP Domain Sequences for d1t6db2:

Sequence; same for both SEQRES and ATOM records:

>d1t6db2 c.55.1.8 (B:133-307) Exopolyphosphatase Ppx {Aquifex aeolicus}
pegevmvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevkrffefl
ekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfdtfkeip
seerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvseml

Timeline for d1t6db2:

• d1t6db2 first appeared in SCOP 1.69
  
• d1t6db2 appears in SCOP 1.73
  
• d1t6db2 appears in the current release, SCOPe 2.08