![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.8: Ppx/GppA phosphatase (Pfam 02541) [110630] (1 protein) |
![]() | Protein Exopolyphosphatase Ppx [110631] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries) |
![]() | Domain d1t6da1: 1t6d A:8-132 [106560] |
PDB Entry: 1t6d (more details), 2.15 Å
SCOP Domain Sequences for d1t6da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6da1 c.55.1.8 (A:8-132) Exopolyphosphatase Ppx {Aquifex aeolicus} imrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqvl keykklidefkvermkavateairraknaeeflervkrevglvvevitpeqegryaylav ayslk
Timeline for d1t6da1: