SCOP 1.75: Domain d1t6ca2: 1t6c A:133-312

Lineage for d1t6ca2 (1t6c A:133-312)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein)
   Pfam PF02541

6. Protein Exopolyphosphatase Ppx [110631] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [110632] (3 PDB entries)
   Uniprot O67040

8. Domain d1t6ca2: 1t6c A:133-312 [106559]
   complexed with ca, cl, iod, mpd

Details for d1t6ca2

PDB Entry: 1t6c, 1.53 Å

PDB Description: Structural characterization of the Ppx/GppA protein family: crystal structure of the Aquifex aeolicus family member

PDB Compounds: (A:) exopolyphosphatase

SCOP Domain Sequences for d1t6ca2:

Sequence; same for both SEQRES and ATOM records:

>d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]}
pegevcvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevkrffefl
ekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfdtfkeip
seerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvsevlkenhs

Timeline for d1t6ca2:

• d1t6ca2 first appeared in SCOP 1.69
  
• d1t6ca2 appears in SCOP 1.73
  
• d1t6ca2 appears in SCOPe 2.01
  
• d1t6ca2 appears in the current release, SCOPe 2.08