Lineage for d1t6ca2 (1t6c A:133-312)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) 
duplication contains two domains of this fold
Family c.55.1.8: Ppx/GppA phosphatase (Pfam 02541) [110630] (1 protein) Protein Exopolyphosphatase Ppx [110631] (1 species) Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries) 
Domain d1t6ca2: 1t6c A:133-312 [106559]
Details for d1t6ca2
PDB Entry: 1t6c (more details), 1.53 Å
PDB Description: Structural characterization of the Ppx/GppA protein family: crystal structure of the Aquifex aeolicus family member
SCOP Domain Sequences for d1t6ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus}
pegevcvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevkrffefl
ekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfdtfkeip
seerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvsevlkenhs
SCOP Domain Coordinates for d1t6ca2:
Click to download the PDB-style file with coordinates for d1t6ca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t6ca2:
- d1t6ca2 is new in SCOP 1.69
- d1t6ca2 appears in SCOP 1.71
- d1t6ca2 appears in the current release, SCOPe 2.08
View in 3D
