| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.8: Ppx/GppA phosphatase (Pfam 02541) [110630] (1 protein) |
| Protein Exopolyphosphatase Ppx [110631] (1 species) |
| Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries) |
| Domain d1t6ca2: 1t6c A:133-312 [106559] |
PDB Entry: 1t6c (more details), 1.53 Å
SCOP Domain Sequences for d1t6ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus}
pegevcvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevkrffefl
ekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfdtfkeip
seerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvsevlkenhs
Timeline for d1t6ca2: