| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein) Pfam 02541 |
| Protein Exopolyphosphatase Ppx [110631] (1 species) |
| Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries) |
| Domain d1t6ca1: 1t6c A:7-132 [106558] |
PDB Entry: 1t6c (more details), 1.53 Å
SCOP Domain Sequences for d1t6ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus}
pimrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqv
lkeykklidefkvervkavateairraknaeeflervkrevglvvevitpeqegryayla
vayslk
Timeline for d1t6ca1: