![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
![]() | Domain d1t66l2: 1t66 L:113-219 [106552] Other proteins in same PDB: d1t66c1, d1t66d1, d1t66d2, d1t66h1, d1t66h2, d1t66l1 complexed with flu |
PDB Entry: 1t66 (more details), 2.3 Å
SCOP Domain Sequences for d1t66l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t66l2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqn skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1t66l2: