Lineage for d1t66h2 (1t66 H:119-220)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655524Domain d1t66h2: 1t66 H:119-220 [106550]
    Other proteins in same PDB: d1t66c1, d1t66c2, d1t66d1, d1t66h1, d1t66l1, d1t66l2
    complexed with flu

Details for d1t66h2

PDB Entry: 1t66 (more details), 2.3 Å

PDB Description: The structure of FAB with intermediate affinity for fluorescein.
PDB Compounds: (H:) immunoglobulin heavy chain

SCOP Domain Sequences for d1t66h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t66h2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsa
lytltssvtvpssswpsqtvtcnvahpasstkvdkkivprnc

SCOP Domain Coordinates for d1t66h2:

Click to download the PDB-style file with coordinates for d1t66h2.
(The format of our PDB-style files is described here.)

Timeline for d1t66h2: