Lineage for d1t66h1 (1t66 H:1-118)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 781998Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (47 PDB entries)
    Uniprot P01796 #
    HV27_MOUSE Ig heavy chain V-III region A4
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 782033Domain d1t66h1: 1t66 H:1-118 [106549]
    Other proteins in same PDB: d1t66c1, d1t66c2, d1t66d2, d1t66h2, d1t66l1, d1t66l2
    complexed with flu

Details for d1t66h1

PDB Entry: 1t66 (more details), 2.3 Å

PDB Description: The structure of FAB with intermediate affinity for fluorescein.
PDB Compounds: (H:) immunoglobulin heavy chain

SCOP Domain Sequences for d1t66h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t66h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
yysdsvkgrftisrddskssvylqmnnlraedmgiyyctsygyhgaywgqgtlvtvsa

SCOP Domain Coordinates for d1t66h1:

Click to download the PDB-style file with coordinates for d1t66h1.
(The format of our PDB-style files is described here.)

Timeline for d1t66h1: